PKNOX1 monoclonal antibody (M01), clone 4F6 View larger

PKNOX1 monoclonal antibody (M01), clone 4F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PKNOX1 monoclonal antibody (M01), clone 4F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about PKNOX1 monoclonal antibody (M01), clone 4F6

Brand: Abnova
Reference: H00005316-M01
Product name: PKNOX1 monoclonal antibody (M01), clone 4F6
Product description: Mouse monoclonal antibody raised against a partial recombinant PKNOX1.
Clone: 4F6
Isotype: IgG2a Kappa
Gene id: 5316
Gene name: PKNOX1
Gene alias: PREP1|pkonx1c
Gene description: PBX/knotted 1 homeobox 1
Genbank accession: NM_004571
Immunogen: PKNOX1 (NP_004562, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPPPVESQTPMDVDKQAIYRHPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQ
Protein accession: NP_004562
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005316-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005316-M01-1-19-1.jpg
Application image note: PKNOX1 monoclonal antibody (M01), clone 4F6 Western Blot analysis of PKNOX1 expression in IMR-32 ( Cat # L008V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PKNOX1 monoclonal antibody (M01), clone 4F6 now

Add to cart