Brand: | Abnova |
Reference: | H00005313-M08 |
Product name: | PKLR monoclonal antibody (M08), clone 3C7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PKLR. |
Clone: | 3C7 |
Isotype: | IgG2b Kappa |
Gene id: | 5313 |
Gene name: | PKLR |
Gene alias: | PK1|PKL|PKR|PKRL|RPK |
Gene description: | pyruvate kinase, liver and RBC |
Genbank accession: | BC025737 |
Immunogen: | PKLR (AAH25737, 485 a.a. ~ 574 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS |
Protein accession: | AAH25737 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |