PKLR monoclonal antibody (M01), clone 3B11 View larger

PKLR monoclonal antibody (M01), clone 3B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PKLR monoclonal antibody (M01), clone 3B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about PKLR monoclonal antibody (M01), clone 3B11

Brand: Abnova
Reference: H00005313-M01
Product name: PKLR monoclonal antibody (M01), clone 3B11
Product description: Mouse monoclonal antibody raised against a partial recombinant PKLR.
Clone: 3B11
Isotype: IgG2a Kappa
Gene id: 5313
Gene name: PKLR
Gene alias: PK1|PKL|PKR|PKRL|RPK
Gene description: pyruvate kinase, liver and RBC
Genbank accession: BC025737
Immunogen: PKLR (AAH25737, 485 a.a. ~ 574 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS
Protein accession: AAH25737
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy PKLR monoclonal antibody (M01), clone 3B11 now

Add to cart