PITX2 (Human) Recombinant Protein (Q02) View larger

PITX2 (Human) Recombinant Protein (Q02)

New product

279,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PITX2 (Human) Recombinant Protein (Q02)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about PITX2 (Human) Recombinant Protein (Q02)

Brand: Abnova
Reference: H00005308-Q02
Product name: PITX2 (Human) Recombinant Protein (Q02)
Product description: Human PITX2 partial ORF ( NP_700476, 82 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 5308
Gene name: PITX2
Gene alias: ARP1|Brx1|IDG2|IGDS|IGDS2|IHG2|IRID2|MGC111022|MGC20144|Otlx2|PTX2|RGS|RIEG|RIEG1|RS
Gene description: paired-like homeodomain 2
Genbank accession: NM_153427
Immunogen sequence/protein sequence: RVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNS
Protein accession: NP_700476
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00005308-Q02-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PITX2 (Human) Recombinant Protein (Q02) now

Add to cart