PITX2 monoclonal antibody (M02), clone 3D2 View larger

PITX2 monoclonal antibody (M02), clone 3D2

H00005308-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PITX2 monoclonal antibody (M02), clone 3D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about PITX2 monoclonal antibody (M02), clone 3D2

Brand: Abnova
Reference: H00005308-M02
Product name: PITX2 monoclonal antibody (M02), clone 3D2
Product description: Mouse monoclonal antibody raised against a full length recombinant PITX2.
Clone: 3D2
Isotype: IgG1 Kappa
Gene id: 5308
Gene name: PITX2
Gene alias: ARP1|Brx1|IDG2|IGDS|IGDS2|IHG2|IRID2|MGC111022|MGC20144|Otlx2|PTX2|RGS|RIEG|RIEG1|RS
Gene description: paired-like homeodomain 2
Genbank accession: BC013998
Immunogen: PITX2 (AAH13998, 1 a.a. ~ 324 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV
Protein accession: AAH13998
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005308-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (61.38 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005308-M02-1-9-1.jpg
Application image note: PITX2 monoclonal antibody (M02), clone 3D2 Western Blot analysis of PITX2 expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PITX2 monoclonal antibody (M02), clone 3D2 now

Add to cart