PITX1 monoclonal antibody (M01), clone 5G4 View larger

PITX1 monoclonal antibody (M01), clone 5G4

H00005307-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PITX1 monoclonal antibody (M01), clone 5G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab

More info about PITX1 monoclonal antibody (M01), clone 5G4

Brand: Abnova
Reference: H00005307-M01
Product name: PITX1 monoclonal antibody (M01), clone 5G4
Product description: Mouse monoclonal antibody raised against a partial recombinant PITX1.
Clone: 5G4
Isotype: IgG2a Kappa
Gene id: 5307
Gene name: PITX1
Gene alias: BFT|POTX|PTX1
Gene description: paired-like homeodomain 1
Genbank accession: NM_002653
Immunogen: PITX1 (NP_002644, 225 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYN
Protein accession: NP_002644
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005307-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005307-M01-1-25-1.jpg
Application image note: PITX1 monoclonal antibody (M01), clone 5G4 Western Blot analysis of PITX1 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab
Shipping condition: Dry Ice
Publications: Transcriptional activation of p53 by Pitx1.Liu DX, Lobie PE.
Cell Death Differ. 2007 Nov;14(11):1893-907. Epub 2007 Aug 31.

Reviews

Buy PITX1 monoclonal antibody (M01), clone 5G4 now

Add to cart