Brand: | Abnova |
Reference: | H00005307-M01 |
Product name: | PITX1 monoclonal antibody (M01), clone 5G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PITX1. |
Clone: | 5G4 |
Isotype: | IgG2a Kappa |
Gene id: | 5307 |
Gene name: | PITX1 |
Gene alias: | BFT|POTX|PTX1 |
Gene description: | paired-like homeodomain 1 |
Genbank accession: | NM_002653 |
Immunogen: | PITX1 (NP_002644, 225 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYN |
Protein accession: | NP_002644 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005307-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005307-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005307-M01-1-25-1.jpg](http://www.abnova.com/application_image/H00005307-M01-1-25-1.jpg) |
Application image note: | PITX1 monoclonal antibody (M01), clone 5G4 Western Blot analysis of PITX1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
Shipping condition: | Dry Ice |
Publications: | Transcriptional activation of p53 by Pitx1.Liu DX, Lobie PE. Cell Death Differ. 2007 Nov;14(11):1893-907. Epub 2007 Aug 31. |