Brand: | Abnova |
Reference: | H00005306-M01 |
Product name: | PITPNA monoclonal antibody (M01), clone 4G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PITPNA. |
Clone: | 4G10 |
Isotype: | IgG2a Kappa |
Gene id: | 5306 |
Gene name: | PITPNA |
Gene alias: | MGC99649|PITPN|VIB1A |
Gene description: | phosphatidylinositol transfer protein, alpha |
Genbank accession: | NM_006224 |
Immunogen: | PITPNA (NP_006215.1, 171 a.a. ~ 270 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD |
Protein accession: | NP_006215.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005306-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005306-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![H00005306-M01-1-12-1.jpg](http://www.abnova.com/application_image/H00005306-M01-1-12-1.jpg) |
Application image note: | PITPNA monoclonal antibody (M01), clone 4G10. Western Blot analysis of PITPNA expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |