Brand: | Abnova |
Reference: | H00005300-M01 |
Product name: | PIN1 monoclonal antibody (M01), clone 2F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PIN1. |
Clone: | 2F2 |
Isotype: | IgG2b Kappa |
Gene id: | 5300 |
Gene name: | PIN1 |
Gene alias: | DOD|UBL5 |
Gene description: | peptidylprolyl cis/trans isomerase, NIMA-interacting 1 |
Genbank accession: | BC002899 |
Immunogen: | PIN1 (AAH02899, 64 a.a. ~ 163 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE |
Protein accession: | AAH02899 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005300-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005300-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005300-M01-1-6-1.jpg](http://www.abnova.com/application_image/H00005300-M01-1-6-1.jpg) |
Application image note: | PIN1 monoclonal antibody (M01), clone 2F2 Western Blot analysis of PIN1 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |