Brand: | Abnova |
Reference: | H00005298-M02 |
Product name: | PIK4CB monoclonal antibody (M02), clone 3B1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PIK4CB. |
Clone: | 3B1 |
Isotype: | IgG2b Kappa |
Gene id: | 5298 |
Gene name: | PI4KB |
Gene alias: | PI4K-BETA|PI4KIIIbeta|PI4Kbeta|PIK4CB|pi4K92 |
Gene description: | phosphatidylinositol 4-kinase, catalytic, beta |
Genbank accession: | NM_002651 |
Immunogen: | PIK4CB (NP_002642.1, 731 a.a. ~ 828 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM |
Protein accession: | NP_002642.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005298-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005298-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005298-M02-9-18-1.jpg](http://www.abnova.com/application_image/H00005298-M02-9-18-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged PIK4CB is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |