Brand: | Abnova |
Reference: | H00005294-M02 |
Product name: | PIK3CG monoclonal antibody (M02), clone 2G3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PIK3CG. |
Clone: | 2G3 |
Isotype: | IgG2a Kappa |
Gene id: | 5294 |
Gene name: | PIK3CG |
Gene alias: | PI3CG|PI3K|PI3Kgamma|PIK3 |
Gene description: | phosphoinositide-3-kinase, catalytic, gamma polypeptide |
Genbank accession: | BC035683 |
Immunogen: | PIK3CG (AAH35683, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLHVAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLY |
Protein accession: | AAH35683 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Detection limit for recombinant GST tagged PIK3CG is approximately 10ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |