Brand: | Abnova |
Reference: | H00005292-M02 |
Product name: | PIM1 monoclonal antibody (M02), clone 2C8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PIM1. |
Clone: | 2C8 |
Isotype: | IgG2a Kappa |
Gene id: | 5292 |
Gene name: | PIM1 |
Gene alias: | PIM |
Gene description: | pim-1 oncogene |
Genbank accession: | BC020224.1 |
Immunogen: | PIM1 (AAH20224.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGF |
Protein accession: | AAH20224.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005292-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005292-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged PIM1 is approximately 10ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |