PIGH monoclonal antibody (M01), clone 2F8 View larger

PIGH monoclonal antibody (M01), clone 2F8

H00005283-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PIGH monoclonal antibody (M01), clone 2F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PIGH monoclonal antibody (M01), clone 2F8

Brand: Abnova
Reference: H00005283-M01
Product name: PIGH monoclonal antibody (M01), clone 2F8
Product description: Mouse monoclonal antibody raised against a partial recombinant PIGH.
Clone: 2F8
Isotype: IgG2a Kappa
Gene id: 5283
Gene name: PIGH
Gene alias: GPI-H
Gene description: phosphatidylinositol glycan anchor biosynthesis, class H
Genbank accession: NM_004569
Immunogen: PIGH (NP_004560, 89 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TLLIIDSLGIQMTSSYASGKESTTFIEMGKVKDIVINEAIYMQKVIYYLCILLKDPVEPHGISQVVPVFQSAKPRLDCLIEVYRSCQEILAHQKATSTSP
Protein accession: NP_004560
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005283-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged PIGH is approximately 10ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PIGH monoclonal antibody (M01), clone 2F8 now

Add to cart