PIGC monoclonal antibody (M01), clone 1G2 View larger

PIGC monoclonal antibody (M01), clone 1G2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PIGC monoclonal antibody (M01), clone 1G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PIGC monoclonal antibody (M01), clone 1G2

Brand: Abnova
Reference: H00005279-M01
Product name: PIGC monoclonal antibody (M01), clone 1G2
Product description: Mouse monoclonal antibody raised against a partial recombinant PIGC.
Clone: 1G2
Isotype: IgG2a Kappa
Gene id: 5279
Gene name: PIGC
Gene alias: GPI2|MGC2049
Gene description: phosphatidylinositol glycan anchor biosynthesis, class C
Genbank accession: NM_002642
Immunogen: PIGC (NP_002633, 1 a.a. ~ 54 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFE
Protein accession: NP_002633
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005279-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.68 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005279-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PIGC is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PIGC monoclonal antibody (M01), clone 1G2 now

Add to cart