SERPINI1 monoclonal antibody (M03), clone 1E10 View larger

SERPINI1 monoclonal antibody (M03), clone 1E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SERPINI1 monoclonal antibody (M03), clone 1E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SERPINI1 monoclonal antibody (M03), clone 1E10

Brand: Abnova
Reference: H00005274-M03
Product name: SERPINI1 monoclonal antibody (M03), clone 1E10
Product description: Mouse monoclonal antibody raised against a full-length recombinant SERPINI1.
Clone: 1E10
Isotype: IgG1 Kappa
Gene id: 5274
Gene name: SERPINI1
Gene alias: DKFZp781N13156|PI12|neuroserpin
Gene description: serpin peptidase inhibitor, clade I (neuroserpin), member 1
Genbank accession: BC018043
Immunogen: SERPINI1 (AAH18043, 17 a.a. ~ 410 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQEEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLYDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL
Protein accession: AAH18043
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005274-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (69.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005274-M03-1-1-1.jpg
Application image note: SERPINI1 monoclonal antibody (M03), clone 1E10. Western Blot analysis of SERPINI1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SERPINI1 monoclonal antibody (M03), clone 1E10 now

Add to cart