Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00005273-M09 |
Product name: | SERPINB10 monoclonal antibody (M09), clone 2B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SERPINB10. |
Clone: | 2B8 |
Isotype: | IgG2b Lambda |
Gene id: | 5273 |
Gene name: | SERPINB10 |
Gene alias: | PI10|bomapin |
Gene description: | serpin peptidase inhibitor, clade B (ovalbumin), member 10 |
Genbank accession: | NM_005024 |
Immunogen: | SERPINB10 (NP_005015.1, 46 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AKGTTAAQMAQVLQFNRDQGVKCDPESEKKRKMEFNLSNSEEIHSDFQTLISEILKPNDDYLLKTANAIYGEKTYAFHNKYLEDMKTYFGAEPQPVNFVE |
Protein accession: | NP_005015.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SERPINB10 expression in transfected 293T cell line by SERPINB10 monoclonal antibody (M09), clone 2B8. Lane 1: SERPINB10 transfected lysate (Predicted MW: 45.4 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |