PI3 monoclonal antibody (M02), clone 2G20 View larger

PI3 monoclonal antibody (M02), clone 2G20

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PI3 monoclonal antibody (M02), clone 2G20

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr,IP

More info about PI3 monoclonal antibody (M02), clone 2G20

Brand: Abnova
Reference: H00005266-M02
Product name: PI3 monoclonal antibody (M02), clone 2G20
Product description: Mouse monoclonal antibody raised against a full-length recombinant PI3.
Clone: 2G20
Isotype: IgG2a Kappa
Gene id: 5266
Gene name: PI3
Gene alias: ESI|MGC13613|SKALP|WAP3|WFDC14|cementoin
Gene description: peptidase inhibitor 3, skin-derived
Genbank accession: BC010952
Immunogen: PI3 (AAH10952, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Protein accession: AAH10952
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005266-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.61 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005266-M02-31-15-1.jpg
Application image note: Immunoprecipitation of PI3 transfected lysate using anti-PI3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PI3 monoclonal antibody.
Applications: ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy PI3 monoclonal antibody (M02), clone 2G20 now

Add to cart