Brand: | Abnova |
Reference: | H00005266-M01 |
Product name: | PI3 monoclonal antibody (M01), clone 3G9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PI3. |
Clone: | 3G9 |
Isotype: | IgG1 kappa |
Gene id: | 5266 |
Gene name: | PI3 |
Gene alias: | ESI|MGC13613|SKALP|WAP3|WFDC14|cementoin |
Gene description: | peptidase inhibitor 3, skin-derived |
Genbank accession: | BC010952 |
Immunogen: | PI3 (AAH10952, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ |
Protein accession: | AAH10952 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.61 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PI3 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |