Brand: | Abnova |
Reference: | H00005256-M04 |
Product name: | PHKA2 monoclonal antibody (M04), clone 3H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PHKA2. |
Clone: | 3H3 |
Isotype: | IgG2a Kappa |
Gene id: | 5256 |
Gene name: | PHKA2 |
Gene alias: | GSD9A|MGC133071|PHK|PYK|PYKL|XLG|XLG2 |
Gene description: | phosphorylase kinase, alpha 2 (liver) |
Genbank accession: | NM_000292 |
Immunogen: | PHKA2 (NP_000283, 428 a.a. ~ 521 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RRFSTSVKPDVVVQVTVLAENNHIKDLLRKHGVNVQSIADIHPIQVQPGRILSHIYAKLGRNKNMNLSGRPYRHIGVLGTSKLYVIRNQIFTFT |
Protein accession: | NP_000283 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005256-M04-3-45-1-L.jpg](http://www.abnova.com/application_image/H00005256-M04-3-45-1-L.jpg) |
Application image note: | Immunoperoxidase of monoclonal antibody to PHKA2 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,ELISA |
Shipping condition: | Dry Ice |