PHF2 monoclonal antibody (M02A), clone 3E7 View larger

PHF2 monoclonal antibody (M02A), clone 3E7

H00005253-M02A_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PHF2 monoclonal antibody (M02A), clone 3E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PHF2 monoclonal antibody (M02A), clone 3E7

Brand: Abnova
Reference: H00005253-M02A
Product name: PHF2 monoclonal antibody (M02A), clone 3E7
Product description: Mouse monoclonal antibody raised against a partial recombinant PHF2.
Clone: 3E7
Isotype: IgM Kappa
Gene id: 5253
Gene name: PHF2
Gene alias: GRC5|JHDM1E|KIAA0662|MGC176680
Gene description: PHD finger protein 2
Genbank accession: NM_005392
Immunogen: PHF2 (NP_005383, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRTWHKHGPGQAPDVKPVQNGSQLFIKELRSRTFPS
Protein accession: NP_005383
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005253-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PHF2 monoclonal antibody (M02A), clone 3E7 now

Add to cart