PHB monoclonal antibody (M01), clone 3F4-2B2 View larger

PHB monoclonal antibody (M01), clone 3F4-2B2

H00005245-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PHB monoclonal antibody (M01), clone 3F4-2B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about PHB monoclonal antibody (M01), clone 3F4-2B2

Brand: Abnova
Reference: H00005245-M01
Product name: PHB monoclonal antibody (M01), clone 3F4-2B2
Product description: Mouse monoclonal antibody raised against a full length recombinant PHB.
Clone: 3F4-2B2
Isotype: IgG2a kappa
Gene id: 5245
Gene name: PHB
Gene alias: PHB1
Gene description: prohibitin
Genbank accession: BC013401
Immunogen: PHB (AAH13401, 1 a.a. ~ 272 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAGDIAYQLSRSRNITYLPAGQSVLLQLPQ
Protein accession: AAH13401
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005245-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (55.66 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00005245-M01-3-5-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to PHB on formalin-fixed paraffin-embedded human tonsil tissue.[antibody concentration 5 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Gonad differential proteins revealed with proteomics in oyster (Saccostrea cucullata) using alga as food contaminated with cadmium.Zhu B, Gao KS, Wang KJ, Ke CH, Huang HQ.
Chemosphere. 2012 Jan 7. [Epub ahead of print]

Reviews

Buy PHB monoclonal antibody (M01), clone 3F4-2B2 now

Add to cart