PGR monoclonal antibody (M07), clone 5D10 View larger

PGR monoclonal antibody (M07), clone 5D10

H00005241-M07_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PGR monoclonal antibody (M07), clone 5D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re

More info about PGR monoclonal antibody (M07), clone 5D10

Brand: Abnova
Reference: H00005241-M07
Product name: PGR monoclonal antibody (M07), clone 5D10
Product description: Mouse monoclonal antibody raised against a partial recombinant PGR. This PGR gene uses two distinct promoters and translation start sites in the first exon to produce two isoforms, A and B. The two isoforms are identical except for the additional 165 amino acids found in the N-terminus of isoform B. Our immunogen corresponds to the specific region of isoform B, thus this antibody is a PGR isofrom B specific antibody.
Clone: 5D10
Isotype: IgG1 Kappa
Gene id: 5241
Gene name: PGR
Gene alias: NR3C3|PR
Gene description: progesterone receptor
Genbank accession: NM_000926
Immunogen: PGR (NP_000917, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGL
Protein accession: NP_000917
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005241-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005241-M07-3-31-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: In Silico Prediction for Regulation of Transcription Factors onTheir Shared Target Genes Indicates Relevant Clinical Implications in a Breast Cancer Population.Liu LY, Chang LY, Kuo WH, Hwa HL, Shyu MK, Chang KJ, Hsieh FJ.
Cancer Inform. 2012;11:113-37. Epub 2012 Apr 19.

Reviews

Buy PGR monoclonal antibody (M07), clone 5D10 now

Add to cart