PGR monoclonal antibody (M05A), clone 1B11 View larger

PGR monoclonal antibody (M05A), clone 1B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PGR monoclonal antibody (M05A), clone 1B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about PGR monoclonal antibody (M05A), clone 1B11

Brand: Abnova
Reference: H00005241-M05A
Product name: PGR monoclonal antibody (M05A), clone 1B11
Product description: Mouse monoclonal antibody raised against a partial recombinant PGR.
Clone: 1B11
Isotype: IgG1 Kappa
Gene id: 5241
Gene name: PGR
Gene alias: NR3C3|PR
Gene description: progesterone receptor
Genbank accession: NM_000926
Immunogen: PGR (NP_000917, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGL
Protein accession: NP_000917
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005241-M05A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005241-M05A-1-9-1.jpg
Application image note: PGR monoclonal antibody (M05A), clone 1B11 Western Blot analysis of PGR expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PGR monoclonal antibody (M05A), clone 1B11 now

Add to cart