PGK1 monoclonal antibody (M02), clone 2H4 View larger

PGK1 monoclonal antibody (M02), clone 2H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PGK1 monoclonal antibody (M02), clone 2H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about PGK1 monoclonal antibody (M02), clone 2H4

Brand: Abnova
Reference: H00005230-M02
Product name: PGK1 monoclonal antibody (M02), clone 2H4
Product description: Mouse monoclonal antibody raised against a partial recombinant PGK1.
Clone: 2H4
Isotype: IgG2a Kappa
Gene id: 5230
Gene name: PGK1
Gene alias: MGC117307|MGC142128|MGC8947|MIG10|PGKA
Gene description: phosphoglycerate kinase 1
Genbank accession: NM_000291
Immunogen: PGK1 (NP_000282, 321 a.a. ~ 417 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI
Protein accession: NP_000282
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005230-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005230-M02-1-12-1.jpg
Application image note: PGK1 monoclonal antibody (M02), clone 2H4. Western Blot analysis of PGK1 expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PGK1 monoclonal antibody (M02), clone 2H4 now

Add to cart