Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PGGT1B monoclonal antibody (M02), clone 5E4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about PGGT1B monoclonal antibody (M02), clone 5E4
| Brand: | Abnova |
| Reference: | H00005229-M02 |
| Product name: | PGGT1B monoclonal antibody (M02), clone 5E4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PGGT1B. |
| Clone: | 5E4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5229 |
| Gene name: | PGGT1B |
| Gene alias: | BGGI|GGTI |
| Gene description: | protein geranylgeranyltransferase type I, beta subunit |
| Genbank accession: | NM_005023 |
| Immunogen: | PGGT1B (NP_005014, 1 a.a. ~ 105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MVATEDERLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDMLDSLDVVNKDDIIEWIYSLQVLPTEDRSNLNRCGFRGSSYLGIPF |
| Protein accession: | NP_005014 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | PGGT1B monoclonal antibody (M02), clone 5E4 Western Blot analysis of PGGT1B expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Genetic studies on the functional relevance of the protein prenyltransferases in skin keratinocytes.Lee R, Chang SY, Trinh H, Tu Y, White AC, Davies BS, Bergo MO, Fong LG, Lowry WE, Young SG. Hum Mol Genet. 2010 Feb 11. [Epub ahead of print] |