PGD monoclonal antibody (M01J), clone S1 View larger

PGD monoclonal antibody (M01J), clone S1

New product

504,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PGD monoclonal antibody (M01J), clone S1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PGD monoclonal antibody (M01J), clone S1

Brand: Abnova
Reference: H00005226-M01J
Product name: PGD monoclonal antibody (M01J), clone S1
Product description: Mouse monoclonal antibody raised against a full-length recombinant PGD.
Clone: S1
Isotype: IgG1 Kappa
Gene id: 5226
Gene name: PGD
Gene alias: 6PGD
Gene description: phosphogluconate dehydrogenase
Genbank accession: BC000368
Immunogen: PGD (AAH00368, 1 a.a. ~ 483 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA
Protein accession: AAH00368
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005226-M01J-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (78.87 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PGD monoclonal antibody (M01J), clone S1 now

Add to cart