Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PGAM1 monoclonal antibody (M01), clone 2G1-A6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Tr |
More info about PGAM1 monoclonal antibody (M01), clone 2G1-A6
| Brand: | Abnova |
| Reference: | H00005223-M01 |
| Product name: | PGAM1 monoclonal antibody (M01), clone 2G1-A6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PGAM1. |
| Clone: | 2G1-A6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5223 |
| Gene name: | PGAM1 |
| Gene alias: | PGAM-B|PGAMA |
| Gene description: | phosphoglycerate mutase 1 (brain) |
| Genbank accession: | BC011678 |
| Immunogen: | PGAM1 (AAH11678.1, 1 a.a. ~ 254 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK |
| Protein accession: | AAH11678.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PGAM1 monoclonal antibody (M01), clone 2G1-A6 Western Blot analysis of PGAM1 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Comparative Proteomic Profiling of Human Bile Reveals SSP411 as a Novel Biomarker of Cholangiocarcinoma.Shen J, Wang W, Wu J, Feng B, Chen W, Wang M, Tang J, Wang F, Cheng F, Pu L, Tang Q, Wang X, Li X. PLoS One. 2012;7(10):e47476. doi: 10.1371/journal.pone.0047476. Epub 2012 Oct 31. |