Brand: | Abnova |
Reference: | H00005223-A01 |
Product name: | PGAM1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant PGAM1. |
Gene id: | 5223 |
Gene name: | PGAM1 |
Gene alias: | PGAM-B|PGAMA |
Gene description: | phosphoglycerate mutase 1 (brain) |
Genbank accession: | BC011678 |
Immunogen: | PGAM1 (AAH11678.1, 1 a.a. ~ 254 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK |
Protein accession: | AAH11678.1 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005223-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005223-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (54.05 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |