Brand: | Abnova |
Reference: | H00005216-A02 |
Product name: | PFN1 polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant PFN1. |
Gene id: | 5216 |
Gene name: | PFN1 |
Gene alias: | - |
Gene description: | profilin 1 |
Genbank accession: | BC015164 |
Immunogen: | PFN1 (AAH15164, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY |
Protein accession: | AAH15164 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (41.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PFN1 polyclonal antibody (A02), Lot # 051129JC01 Western Blot analysis of PFN1 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |