Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PFN1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about PFN1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005216-A01 |
| Product name: | PFN1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant PFN1. |
| Gene id: | 5216 |
| Gene name: | PFN1 |
| Gene alias: | - |
| Gene description: | profilin 1 |
| Genbank accession: | BC006768 |
| Immunogen: | PFN1 (AAH06768, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY |
| Protein accession: | AAH06768 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.51 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | PFN1 polyclonal antibody (A01), Lot # Abnova060427QCS1 Western Blot analysis of PFN1 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |