Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PFKFB3 monoclonal antibody (M08), clone 3F3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about PFKFB3 monoclonal antibody (M08), clone 3F3
| Brand: | Abnova |
| Reference: | H00005209-M08 |
| Product name: | PFKFB3 monoclonal antibody (M08), clone 3F3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PFKFB3. |
| Clone: | 3F3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5209 |
| Gene name: | PFKFB3 |
| Gene alias: | IPFK2|PFK2 |
| Gene description: | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 |
| Genbank accession: | NM_004566 |
| Immunogen: | PFKFB3 (NP_004557, 412 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH |
| Protein accession: | NP_004557 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PFKFB3 is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Reduced methylation of PFKFB3 in cancer cells shunts glucose towards the pentose phosphate pathway.Yamamoto T, Takano N, Ishiwata K, Ohmura M, Nagahata Y, Matsuura T, Kamata A, Sakamoto K, Nakanishi T, Kubo A, Hishiki T, Suematsu M Nat Commun. 2014 Mar 17;5:3480. doi: 10.1038/ncomms4480. |