Brand: | Abnova |
Reference: | H00005205-M02 |
Product name: | ATP8B1 monoclonal antibody (M02), clone 3F10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP8B1. |
Clone: | 3F10 |
Isotype: | IgG1 Kappa |
Gene id: | 5205 |
Gene name: | ATP8B1 |
Gene alias: | ATPIC|BRIC|FIC1|PFIC|PFIC1 |
Gene description: | ATPase, class I, type 8B, member 1 |
Genbank accession: | NM_005603 |
Immunogen: | ATP8B1 (NP_005594.1, 471 a.a. ~ 551 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | INGQIYGDHRDASQHNHNKIEQVDFSWNTYADGKLAFYDHYLIEQIQSGKEPEVRQFFFLLAVCHTVMVDRTDGQLNYQAA |
Protein accession: | NP_005594.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ATP8B1 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |