Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PFDN2 monoclonal antibody (M07), clone 2C1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about PFDN2 monoclonal antibody (M07), clone 2C1
| Reference: | H00005202-M07 |
| Product name: | PFDN2 monoclonal antibody (M07), clone 2C1 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PFDN2. |
| Clone: | 2C1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5202 |
| Gene name: | PFDN2 |
| Gene alias: | PFD2 |
| Gene description: | prefoldin subunit 2 |
| Genbank accession: | BC012464 |
| Immunogen: | PFDN2 (AAH12464, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS |
| Protein accession: | AAH12464 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |