PFDN2 MaxPab mouse polyclonal antibody (B01) View larger

PFDN2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PFDN2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PFDN2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00005202-B01
Product name: PFDN2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human PFDN2 protein.
Gene id: 5202
Gene name: PFDN2
Gene alias: PFD2
Gene description: prefoldin subunit 2
Genbank accession: NM_012394
Immunogen: PFDN2 (NP_036526, 1 a.a. ~ 154 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS
Protein accession: NP_036526
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005202-B01-13-15-1.jpg
Application image note: Western Blot analysis of PFDN2 expression in transfected 293T cell line (H00005202-T01) by PFDN2 MaxPab polyclonal antibody.

Lane 1: PFDN2 transfected lysate(16.94 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PFDN2 MaxPab mouse polyclonal antibody (B01) now

Add to cart