PEX10 monoclonal antibody (M01), clone 1B8 View larger

PEX10 monoclonal antibody (M01), clone 1B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PEX10 monoclonal antibody (M01), clone 1B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PEX10 monoclonal antibody (M01), clone 1B8

Brand: Abnova
Reference: H00005192-M01
Product name: PEX10 monoclonal antibody (M01), clone 1B8
Product description: Mouse monoclonal antibody raised against a full length recombinant PEX10.
Clone: 1B8
Isotype: IgG2b Kappa
Gene id: 5192
Gene name: PEX10
Gene alias: MGC1998|NALD|RNF69
Gene description: peroxisomal biogenesis factor 10
Genbank accession: BC018198
Immunogen: PEX10 (AAH18198.1, 1 a.a. ~ 326 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAPAAASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVTLHAVLPYLLDKALLPLEQELQADPDSGRPLQGSLGPGGRGCSGARRWMRHHTATLTEQQRRALLRAVFVLRQGLACLQRLHVAWFYIHGVFYHLAKRLTGITYLRVRSLPGEDLRARVSYRLLGVISLLHLVLSMGLQLYGFRQRQRARKEWRLHRGLSHRRASLEERAVSRNPLCTLCLEERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR
Protein accession: AAH18198.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005192-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (61.6 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005192-M01-13-15-1.jpg
Application image note: Western Blot analysis of PEX10 expression in transfected 293T cell line by PEX10 monoclonal antibody (M01), clone 1B8.

Lane 1: PEX10 transfected lysate(37.069 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PEX10 monoclonal antibody (M01), clone 1B8 now

Add to cart