Brand: | Abnova |
Reference: | H00005191-A01 |
Product name: | PEX7 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PEX7. |
Gene id: | 5191 |
Gene name: | PEX7 |
Gene alias: | PTS2R|RCDP1|RD |
Gene description: | peroxisomal biogenesis factor 7 |
Genbank accession: | NM_000288 |
Immunogen: | PEX7 (NP_000279, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLILDPDEAGLRLFRSFDWNDGLFDVTWSENNEHVLITCSGDGSLQLWDTAK |
Protein accession: | NP_000279 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005191-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005191-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![H00005191-A01-1-27-1.jpg](http://www.abnova.com/application_image/H00005191-A01-1-27-1.jpg) |
Application image note: | PEX7 polyclonal antibody (A01), Lot # 051122JC01. Western Blot analysis of PEX7 expression in Raw 264.7. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |