Brand: | Abnova |
Reference: | H00005188-A01 |
Product name: | PET112L polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PET112L. |
Gene id: | 5188 |
Gene name: | PET112L |
Gene alias: | HSPC199|PET112 |
Gene description: | PET112-like (yeast) |
Genbank accession: | NM_004564 |
Immunogen: | PET112L (NP_004555, 466 a.a. ~ 556 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SAAKQVFEELWKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLS |
Protein accession: | NP_004555 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005188-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005188-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.12 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005188-A01-1-12-1.jpg](http://www.abnova.com/application_image/H00005188-A01-1-12-1.jpg) |
Application image note: | PET112L polyclonal antibody (A01), Lot # 060717JCS1 Western Blot analysis of PET112L expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |