ENPP3 monoclonal antibody (M01), clone 1G11 View larger

ENPP3 monoclonal antibody (M01), clone 1G11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ENPP3 monoclonal antibody (M01), clone 1G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ENPP3 monoclonal antibody (M01), clone 1G11

Brand: Abnova
Reference: H00005169-M01
Product name: ENPP3 monoclonal antibody (M01), clone 1G11
Product description: Mouse monoclonal antibody raised against a partial recombinant ENPP3.
Clone: 1G11
Isotype: IgG2a Kappa
Gene id: 5169
Gene name: ENPP3
Gene alias: B10|CD203c|NPP3|PD-IBETA|PDNP3
Gene description: ectonucleotide pyrophosphatase/phosphodiesterase 3
Genbank accession: NM_005021
Immunogen: ENPP3 (NP_005012, 602 a.a. ~ 699 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ATVKVNLPFGRPRVLQKNVDHCLLYHREYVSGFGKAMRMPMWSSYTVPQLGDTSPLPPTVPDCLRADVRVPPSESQKCSFYLADKNITHGFLYPPASN
Protein accession: NP_005012
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005169-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005169-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ENPP3 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ENPP3 monoclonal antibody (M01), clone 1G11 now

Add to cart