PDK1 monoclonal antibody (M02), clone 3E1 View larger

PDK1 monoclonal antibody (M02), clone 3E1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDK1 monoclonal antibody (M02), clone 3E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about PDK1 monoclonal antibody (M02), clone 3E1

Brand: Abnova
Reference: H00005163-M02
Product name: PDK1 monoclonal antibody (M02), clone 3E1
Product description: Mouse monoclonal antibody raised against a partial recombinant PDK1.
Clone: 3E1
Isotype: IgG1 Kappa
Gene id: 5163
Gene name: PDK1
Gene alias: -
Gene description: pyruvate dehydrogenase kinase, isozyme 1
Genbank accession: BC039158
Immunogen: PDK1 (AAH39158, 203 a.a. ~ 302 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQ
Protein accession: AAH39158
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005163-M02-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged PDK1 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy PDK1 monoclonal antibody (M02), clone 3E1 now

Add to cart