PDGFRA monoclonal antibody (M01), clone 2D2-1A11 View larger

PDGFRA monoclonal antibody (M01), clone 2D2-1A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDGFRA monoclonal antibody (M01), clone 2D2-1A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce

More info about PDGFRA monoclonal antibody (M01), clone 2D2-1A11

Brand: Abnova
Reference: H00005156-M01
Product name: PDGFRA monoclonal antibody (M01), clone 2D2-1A11
Product description: Mouse monoclonal antibody raised against a full length recombinant PDGFRA.
Clone: 2D2-1A11
Isotype: IgG1 kappa
Gene id: 5156
Gene name: PDGFRA
Gene alias: CD140A|MGC74795|PDGFR2|Rhe-PDGFRA
Gene description: platelet-derived growth factor receptor, alpha polypeptide
Genbank accession: BC015186
Immunogen: PDGFRA (AAH15186, 25 a.a. ~ 218 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL
Protein accession: AAH15186
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005156-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (47.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005156-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged PDGFRA is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy PDGFRA monoclonal antibody (M01), clone 2D2-1A11 now

Add to cart