Brand: | Abnova |
Reference: | H00005156-M01 |
Product name: | PDGFRA monoclonal antibody (M01), clone 2D2-1A11 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PDGFRA. |
Clone: | 2D2-1A11 |
Isotype: | IgG1 kappa |
Gene id: | 5156 |
Gene name: | PDGFRA |
Gene alias: | CD140A|MGC74795|PDGFR2|Rhe-PDGFRA |
Gene description: | platelet-derived growth factor receptor, alpha polypeptide |
Genbank accession: | BC015186 |
Immunogen: | PDGFRA (AAH15186, 25 a.a. ~ 218 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL |
Protein accession: | AAH15186 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (47.08 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PDGFRA is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
Shipping condition: | Dry Ice |