Brand: | Abnova |
Reference: | H00005154-A01 |
Product name: | PDGFA polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PDGFA. |
Gene id: | 5154 |
Gene name: | PDGFA |
Gene alias: | PDGF-A|PDGF1 |
Gene description: | platelet-derived growth factor alpha polypeptide |
Genbank accession: | NM_033023 |
Immunogen: | PDGFA (NP_715639, 84 a.a. ~ 193 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | RKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDT |
Protein accession: | NP_715639 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005154-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005154-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |