PDE1B monoclonal antibody (M05), clone 4E8 View larger

PDE1B monoclonal antibody (M05), clone 4E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDE1B monoclonal antibody (M05), clone 4E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PDE1B monoclonal antibody (M05), clone 4E8

Brand: Abnova
Reference: H00005153-M05
Product name: PDE1B monoclonal antibody (M05), clone 4E8
Product description: Mouse monoclonal antibody raised against a partial recombinant PDE1B.
Clone: 4E8
Isotype: IgG2a Kappa
Gene id: 5153
Gene name: PDE1B
Gene alias: PDE1B1|PDES1B
Gene description: phosphodiesterase 1B, calmodulin-dependent
Genbank accession: BC032226
Immunogen: PDE1B (AAH32226, 437 a.a. ~ 536 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
Protein accession: AAH32226
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005153-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PDE1B monoclonal antibody (M05), clone 4E8 now

Add to cart