PDE9A monoclonal antibody (M01), clone 1E1 View larger

PDE9A monoclonal antibody (M01), clone 1E1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDE9A monoclonal antibody (M01), clone 1E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about PDE9A monoclonal antibody (M01), clone 1E1

Brand: Abnova
Reference: H00005152-M01
Product name: PDE9A monoclonal antibody (M01), clone 1E1
Product description: Mouse monoclonal antibody raised against a partial recombinant PDE9A.
Clone: 1E1
Isotype: IgG2a Kappa
Gene id: 5152
Gene name: PDE9A
Gene alias: HSPDE9A2
Gene description: phosphodiesterase 9A
Genbank accession: NM_001001567
Immunogen: PDE9A (NP_001001567.1, 434 a.a. ~ 533 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA
Protein accession: NP_001001567.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005152-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005152-M01-3-52-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to PDE9A on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PDE9A monoclonal antibody (M01), clone 1E1 now

Add to cart