PDE8A monoclonal antibody (M02), clone 1H6 View larger

PDE8A monoclonal antibody (M02), clone 1H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDE8A monoclonal antibody (M02), clone 1H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PDE8A monoclonal antibody (M02), clone 1H6

Brand: Abnova
Reference: H00005151-M02
Product name: PDE8A monoclonal antibody (M02), clone 1H6
Product description: Mouse monoclonal antibody raised against a partial recombinant PDE8A.
Clone: 1H6
Isotype: IgG2a Kappa
Gene id: 5151
Gene name: PDE8A
Gene alias: FLJ16150|HsT19550
Gene description: phosphodiesterase 8A
Genbank accession: NM_002605
Immunogen: PDE8A (NP_002596.1, 32 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFL
Protein accession: NP_002596.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005151-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005151-M02-13-15-1.jpg
Application image note: Western Blot analysis of PDE8A expression in transfected 293T cell line by PDE8A monoclonal antibody (M02), clone 1H6.

Lane 1: PDE8A transfected lysate(93.3 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PDE8A monoclonal antibody (M02), clone 1H6 now

Add to cart