Brand: | Abnova |
Reference: | H00005146-A01 |
Product name: | PDE6C polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PDE6C. |
Gene id: | 5146 |
Gene name: | PDE6C |
Gene alias: | PDEA2 |
Gene description: | phosphodiesterase 6C, cGMP-specific, cone, alpha prime |
Genbank accession: | NM_006204 |
Immunogen: | PDE6C (NP_006195, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | EINQVAVEKYLEENPQFAKEYFDRKLRVEVLGEIFKNSQVPVQSSMSFSELTQVEESALCLELLWTVQEEGGTPEQGVHRALQRLAHLLQADRCSMFL |
Protein accession: | NP_006195 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PDE6C polyclonal antibody (A01), Lot # 060116JC01 Western Blot analysis of PDE6C expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |