PDE4C monoclonal antibody (M03A), clone 6A10 View larger

PDE4C monoclonal antibody (M03A), clone 6A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDE4C monoclonal antibody (M03A), clone 6A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about PDE4C monoclonal antibody (M03A), clone 6A10

Brand: Abnova
Reference: H00005143-M03A
Product name: PDE4C monoclonal antibody (M03A), clone 6A10
Product description: Mouse monoclonal antibody raised against a partial recombinant PDE4C.
Clone: 6A10
Isotype: IgG1 Kappa
Gene id: 5143
Gene name: PDE4C
Gene alias: DPDE1|MGC126222
Gene description: phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila)
Genbank accession: NM_000923
Immunogen: PDE4C (NP_000914, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERDLSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQS
Protein accession: NP_000914
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005143-M03A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005143-M03A-1-4-1.jpg
Application image note: PDE4C monoclonal antibody (M03A), clone 6A10 Western Blot analysis of PDE4C expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PDE4C monoclonal antibody (M03A), clone 6A10 now

Add to cart