Brand: | Abnova |
Reference: | H00005143-M03A |
Product name: | PDE4C monoclonal antibody (M03A), clone 6A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PDE4C. |
Clone: | 6A10 |
Isotype: | IgG1 Kappa |
Gene id: | 5143 |
Gene name: | PDE4C |
Gene alias: | DPDE1|MGC126222 |
Gene description: | phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila) |
Genbank accession: | NM_000923 |
Immunogen: | PDE4C (NP_000914, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERDLSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQS |
Protein accession: | NP_000914 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PDE4C monoclonal antibody (M03A), clone 6A10 Western Blot analysis of PDE4C expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |