Brand: | Abnova |
Reference: | H00005143-A01 |
Product name: | PDE4C polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PDE4C. |
Gene id: | 5143 |
Gene name: | PDE4C |
Gene alias: | DPDE1|MGC126222 |
Gene description: | phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila) |
Genbank accession: | NM_000923 |
Immunogen: | PDE4C (NP_000914, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERDLSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQS |
Protein accession: | NP_000914 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005143-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005143-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |