PDE3B monoclonal antibody (M01), clone 4A4 View larger

PDE3B monoclonal antibody (M01), clone 4A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDE3B monoclonal antibody (M01), clone 4A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PDE3B monoclonal antibody (M01), clone 4A4

Brand: Abnova
Reference: H00005140-M01
Product name: PDE3B monoclonal antibody (M01), clone 4A4
Product description: Mouse monoclonal antibody raised against a partial recombinant PDE3B.
Clone: 4A4
Isotype: IgG2a Kappa
Gene id: 5140
Gene name: PDE3B
Gene alias: HcGIP1|cGIPDE1
Gene description: phosphodiesterase 3B, cGMP-inhibited
Genbank accession: NM_000922
Immunogen: PDE3B (NP_000913, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTH
Protein accession: NP_000913
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005140-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005140-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged PDE3B is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PDE3B monoclonal antibody (M01), clone 4A4 now

Add to cart