Brand: | Abnova |
Reference: | H00005140-A01 |
Product name: | PDE3B polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PDE3B. |
Gene id: | 5140 |
Gene name: | PDE3B |
Gene alias: | HcGIP1|cGIPDE1 |
Gene description: | phosphodiesterase 3B, cGMP-inhibited |
Genbank accession: | NM_000922 |
Immunogen: | PDE3B (NP_000913, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | LTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTH |
Protein accession: | NP_000913 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005140-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005140-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Distinct metabolism of cyclic adenosine monophosphate in regulatory and helper CD4(+) T cells.Bazhin AV, Kahnert S, Kimpfler S, Schadendorf D, Umansky V. Mol Immunol. 2009 Nov 23. [Epub ahead of print] |