PDE3A monoclonal antibody (M03), clone 2D7 View larger

PDE3A monoclonal antibody (M03), clone 2D7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDE3A monoclonal antibody (M03), clone 2D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about PDE3A monoclonal antibody (M03), clone 2D7

Brand: Abnova
Reference: H00005139-M03
Product name: PDE3A monoclonal antibody (M03), clone 2D7
Product description: Mouse monoclonal antibody raised against a partial recombinant PDE3A.
Clone: 2D7
Isotype: IgG2b Kappa
Gene id: 5139
Gene name: PDE3A
Gene alias: CGI-PDE
Gene description: phosphodiesterase 3A, cGMP-inhibited
Genbank accession: NM_000921
Immunogen: PDE3A (NP_000912, 533 a.a. ~ 640 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TPASSLVSKISAVQFPESADTTAKQSLGSHRALTYTQSAPDLSPQILTPPVICSSCGRPYSQGNPADEPLERSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNE
Protein accession: NP_000912
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005139-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005139-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged PDE3A is 0.1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PDE3A monoclonal antibody (M03), clone 2D7 now

Add to cart