Brand: | Abnova |
Reference: | H00005138-A01 |
Product name: | PDE2A polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PDE2A. |
Gene id: | 5138 |
Gene name: | PDE2A |
Gene alias: | PDE2A1|PED2A4 |
Gene description: | phosphodiesterase 2A, cGMP-stimulated |
Genbank accession: | NM_002599 |
Immunogen: | PDE2A (NP_002590, 850 a.a. ~ 940 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | REKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDA |
Protein accession: | NP_002590 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (36.12 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Distinct metabolism of cyclic adenosine monophosphate in regulatory and helper CD4(+) T cells.Bazhin AV, Kahnert S, Kimpfler S, Schadendorf D, Umansky V. Mol Immunol. 2009 Nov 23. [Epub ahead of print] |